ATE1 Antibody

Images

 
Western Blot: ATE1 Antibody [NBP1-54321] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Product Details

Summary
Product Discontinued
View other related ATE1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54321
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATE1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ATE1(arginyltransferase 1) The peptide sequence was selected from the N terminal of ATE1. Peptide sequence CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM.
Clonality
Polyclonal
Host
Rabbit
Gene
ATE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATE1 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATE1 Antibody

  • Arginine-tRNA--protein transferase 1
  • arginyltransferase 1MGC26724
  • arginyl-tRNA--protein transferase 1
  • arginyl-tRNA-protein transferase
  • EC 2.3.2.8
  • R-transferase 1

Background

ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF3026
Species: Mu
Applications: WB
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB666
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-91868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATE1 Antibody (NBP1-54321) (0)

There are no publications for ATE1 Antibody (NBP1-54321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATE1 Antibody (NBP1-54321) (0)

There are no reviews for ATE1 Antibody (NBP1-54321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATE1 Antibody (NBP1-54321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATE1 Products

Bioinformatics Tool for ATE1 Antibody (NBP1-54321)

Discover related pathways, diseases and genes to ATE1 Antibody (NBP1-54321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATE1 Antibody (NBP1-54321)

Discover more about diseases related to ATE1 Antibody (NBP1-54321).
 

Pathways for ATE1 Antibody (NBP1-54321)

View related products by pathway.

PTMs for ATE1 Antibody (NBP1-54321)

Learn more about PTMs related to ATE1 Antibody (NBP1-54321).

Blogs on ATE1

There are no specific blogs for ATE1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATE1
Uniprot