ATBF1/ZFHX3 Antibody (3B1) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related ATBF1/ZFHX3 Primary Antibodies

Order Details


    • Catalog Number
      H00000463-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATBF1/ZFHX3 Antibody (3B1) [PerCP] Summary

Immunogen
ZFHX3 (NP_008816 2811 a.a. - 2910 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG
Specificity
ATBF1 - AT-binding transcription factor 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZFHX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATBF1/ZFHX3 Antibody (3B1) [PerCP]

  • Alpha-fetoprotein enhancer-binding protein
  • AT motif-binding factor 1
  • AT motif-binding factor
  • ATBF1
  • ATBF1alpha-fetoprotein enhancer binding protein
  • AT-binding transcription factor 1ATBT
  • ATBT
  • ZFH3
  • ZFH-3
  • ZFHX3
  • zinc finger homeobox 3
  • zinc finger homeobox protein 3
  • Zinc finger homeodomain protein 3
  • ZNF927

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-55459
Species: Hu
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6897
Species: Hu, Mu
Applications: WB, IHC
AF4937
Species: Hu
Applications: WB, IHC
H00000463-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ATBF1/ZFHX3 Antibody (H00000463-M01PCP) (0)

There are no publications for ATBF1/ZFHX3 Antibody (H00000463-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATBF1/ZFHX3 Antibody (H00000463-M01PCP) (0)

There are no reviews for ATBF1/ZFHX3 Antibody (H00000463-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATBF1/ZFHX3 Antibody (H00000463-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATBF1/ZFHX3 Products

Bioinformatics Tool for ATBF1/ZFHX3 Antibody (H00000463-M01PCP)

Discover related pathways, diseases and genes to ATBF1/ZFHX3 Antibody (H00000463-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATBF1/ZFHX3 Antibody (H00000463-M01PCP)

Discover more about diseases related to ATBF1/ZFHX3 Antibody (H00000463-M01PCP).
 

Pathways for ATBF1/ZFHX3 Antibody (H00000463-M01PCP)

View related products by pathway.

PTMs for ATBF1/ZFHX3 Antibody (H00000463-M01PCP)

Learn more about PTMs related to ATBF1/ZFHX3 Antibody (H00000463-M01PCP).
 

Research Areas for ATBF1/ZFHX3 Antibody (H00000463-M01PCP)

Find related products by research area.

Blogs on ATBF1/ZFHX3

There are no specific blogs for ATBF1/ZFHX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATBF1/ZFHX3 Antibody (3B1) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFHX3
Entrez