Ataxin 7-Like 3 Antibody


Immunocytochemistry/ Immunofluorescence: Ataxin 7-Like 3 Antibody [NBP2-30710] - Staining of human cell line U-2 OS shows positivity in nucleus.
Immunohistochemistry: Ataxin 7-Like 3 Antibody [NBP2-30710] - Staining of human stomach, lower shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Product Discontinued
View other related Ataxin 7-Like 3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ataxin 7-Like 3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNSPRRSKSLKHKNGELSNSDPFKYNNSTGISYETLG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Ataxin 7-Like 3 Antibody

  • Ataxin-7-Like Protein 3
  • ATXN7L3
  • SAGA-Associated Factor 11 Homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Ataxin 7-Like 3 Antibody (NBP2-30710) (0)

There are no publications for Ataxin 7-Like 3 Antibody (NBP2-30710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin 7-Like 3 Antibody (NBP2-30710) (0)

There are no reviews for Ataxin 7-Like 3 Antibody (NBP2-30710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ataxin 7-Like 3 Antibody (NBP2-30710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ataxin 7-Like 3 Products

Bioinformatics Tool for Ataxin 7-Like 3 Antibody (NBP2-30710)

Discover related pathways, diseases and genes to Ataxin 7-Like 3 Antibody (NBP2-30710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin 7-Like 3 Antibody (NBP2-30710)

Discover more about diseases related to Ataxin 7-Like 3 Antibody (NBP2-30710).

Pathways for Ataxin 7-Like 3 Antibody (NBP2-30710)

View related products by pathway.

PTMs for Ataxin 7-Like 3 Antibody (NBP2-30710)

Learn more about PTMs related to Ataxin 7-Like 3 Antibody (NBP2-30710).

Blogs on Ataxin 7-Like 3

There are no specific blogs for Ataxin 7-Like 3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ataxin 7-Like 3 Antibody and receive a gift card or discount.


Gene Symbol ATXN7L3