ASPA Antibody (3C11) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related ASPA Primary Antibodies

Order Details


    • Catalog Number
      H00000443-M09PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ASPA Antibody (3C11) [PerCP] Summary

Immunogen
ASPA (NP_000040, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF
Specificity
aspartoacylase (Canavan disease)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASPA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASPA Antibody (3C11) [PerCP]

  • ACY-2
  • ACY2aminoacylase 2
  • Aminoacylase-2
  • ASPaminoacylase-2
  • aspartoacylase (aminoacylase 2, Canavan disease)
  • aspartoacylase
  • EC 3.5.1.15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56497
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
AF5430
Species: Mu
Applications: WB, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB2388
Species: Hu
Applications: WB, IHC
AF4937
Species: Hu
Applications: WB, IHC

Publications for ASPA Antibody (H00000443-M09PCP) (0)

There are no publications for ASPA Antibody (H00000443-M09PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASPA Antibody (H00000443-M09PCP) (0)

There are no reviews for ASPA Antibody (H00000443-M09PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASPA Antibody (H00000443-M09PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASPA Products

Bioinformatics Tool for ASPA Antibody (H00000443-M09PCP)

Discover related pathways, diseases and genes to ASPA Antibody (H00000443-M09PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASPA Antibody (H00000443-M09PCP)

Discover more about diseases related to ASPA Antibody (H00000443-M09PCP).
 

Pathways for ASPA Antibody (H00000443-M09PCP)

View related products by pathway.

PTMs for ASPA Antibody (H00000443-M09PCP)

Learn more about PTMs related to ASPA Antibody (H00000443-M09PCP).

Blogs on ASPA

There are no specific blogs for ASPA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASPA Antibody (3C11) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPA