Recombinant Human ASCL2/Mash2 Protein

Images

 
SDS-Page: Recombinant Human ASCL2/Mash2 Protein [H00000430-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ASCL2/Mash2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 193 of Human ASCL2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ASCL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
46.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ASCL2/Mash2 Protein

  • achaete-scute complex (Drosophila) homolog-like 2
  • achaete-scute complex homolog 2 (Drosophila)
  • achaete-scute complex-like 2 (Drosophila)
  • ASCL2
  • ASH2
  • ASH-2
  • BHLHA45
  • bHLHa45achaete-scute homolog 2
  • Class A basic helix-loop-helix protein 45
  • HASH2
  • HASH2achaete-scute complex-like 2
  • mammalian achaete/scute homologue 2
  • Mash2

Background

This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB600-250
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00010518-A01
Species: Hu, Ze
Applications: WB, ChIP, ELISA
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB600-252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00000430-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ASCL2/Mash2 Recombinant Protein (H00000430-P01) (0)

There are no publications for ASCL2/Mash2 Recombinant Protein (H00000430-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL2/Mash2 Recombinant Protein (H00000430-P01) (0)

There are no reviews for ASCL2/Mash2 Recombinant Protein (H00000430-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASCL2/Mash2 Recombinant Protein (H00000430-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ASCL2/Mash2 Recombinant Protein (H00000430-P01)

Discover related pathways, diseases and genes to ASCL2/Mash2 Recombinant Protein (H00000430-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL2/Mash2 Recombinant Protein (H00000430-P01)

Discover more about diseases related to ASCL2/Mash2 Recombinant Protein (H00000430-P01).
 

Pathways for ASCL2/Mash2 Recombinant Protein (H00000430-P01)

View related products by pathway.

PTMs for ASCL2/Mash2 Recombinant Protein (H00000430-P01)

Learn more about PTMs related to ASCL2/Mash2 Recombinant Protein (H00000430-P01).

Blogs on ASCL2/Mash2

There are no specific blogs for ASCL2/Mash2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IGF-II
292-G2-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ASCL2/Mash2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL2