ASCL1/Mash1 Antibody (2D9) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ASCL1/Mash1 Primary Antibodies

Order Details


    • Catalog Number
      H00000429-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ASCL1/Mash1 Antibody (2D9) [DyLight 488] Summary

Immunogen
ASCL1 (NP_004307, 137 a.a. - 236 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Specificity
ASCL1 - achaete-scute complex-like 1 (Drosophila)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASCL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASCL1/Mash1 Antibody (2D9) [DyLight 488]

  • achaete-scute complex (Drosophila) homolog-like 1
  • achaete-scute complex homolog 1 (Drosophila)
  • achaete-scute complex-like 1 (Drosophila)
  • achaete-scute homolog 1
  • ASCL1
  • ASH1
  • ASH-1
  • ASH1MASH1
  • BHLHA46
  • bHLHa46achaete-scute complex-like 1
  • Class A basic helix-loop-helix protein 46
  • HASH1
  • HASH1achaete scute protein
  • Mash1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3314
Species: Hu, Rt
Applications: IHC
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for ASCL1/Mash1 Antibody (H00000429-M02G) (0)

There are no publications for ASCL1/Mash1 Antibody (H00000429-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL1/Mash1 Antibody (H00000429-M02G) (0)

There are no reviews for ASCL1/Mash1 Antibody (H00000429-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASCL1/Mash1 Antibody (H00000429-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASCL1/Mash1 Products

Bioinformatics Tool for ASCL1/Mash1 Antibody (H00000429-M02G)

Discover related pathways, diseases and genes to ASCL1/Mash1 Antibody (H00000429-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL1/Mash1 Antibody (H00000429-M02G)

Discover more about diseases related to ASCL1/Mash1 Antibody (H00000429-M02G).
 

Pathways for ASCL1/Mash1 Antibody (H00000429-M02G)

View related products by pathway.

PTMs for ASCL1/Mash1 Antibody (H00000429-M02G)

Learn more about PTMs related to ASCL1/Mash1 Antibody (H00000429-M02G).
 

Research Areas for ASCL1/Mash1 Antibody (H00000429-M02G)

Find related products by research area.

Blogs on ASCL1/Mash1

There are no specific blogs for ASCL1/Mash1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASCL1/Mash1 Antibody (2D9) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL1
Entrez