Recombinant Human ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Protein

Order Details


    • Catalog Number
      H00027163-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 36-104 of Human NAAA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NAAA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Protein

  • Acid ceramidase-like protein
  • ASAHL
  • ASAH-like protein
  • EC 3.5.1.-
  • NAAA
  • N-acylethanolamine acid amidase
  • Nacylethanolaminehydrolyzing Acid Amidase
  • N-acylethanolamine-hydrolyzing acid amidase
  • N-acylsphingosine amidohydrolase (acid ceramidase)-like
  • N-acylsphingosine amidohydrolase-like
  • PLT

Background

ASAHL - N-acylsphingosine amidohydrolase (acid ceramidase)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
366-6C/CF
Species: Hu
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00027163-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01) (0)

There are no publications for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01) (0)

There are no reviews for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Products

Bioinformatics Tool for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01)

Discover related pathways, diseases and genes to ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01)

Discover more about diseases related to ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01).
 

Pathways for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01)

View related products by pathway.

PTMs for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01)

Learn more about PTMs related to ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Partial Recombinant Protein (H00027163-Q01).

Blogs on ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase

There are no specific blogs for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAAA
Entrez