AS3MT Antibody

Images

 
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AS3MT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AS3MT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AS3MT Protein (NBP1-85354PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AS3MT Antibody

  • arsenic (+3 oxidation state) methyltransferase
  • arsenite methyltransferase
  • CYT19methyltransferase cyt19
  • EC 2.1.1.137
  • Methylarsonite methyltransferase
  • S-adenosyl-L-methionine:arsenic(III) methyltransferase
  • S-adenosylmethionine:arsenic (III) methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-55515
Species: Hu
Applications: ICC/IF
AF6486
Species: Hu
Applications: WB, Simple Western
NBP2-14075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-56486
Species: Hu, Mu
Applications: WB
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85354
Species: Hu
Applications: IHC, IHC-P

Publications for AS3MT Antibody (NBP1-85354) (0)

There are no publications for AS3MT Antibody (NBP1-85354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AS3MT Antibody (NBP1-85354) (0)

There are no reviews for AS3MT Antibody (NBP1-85354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AS3MT Antibody (NBP1-85354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AS3MT Products

Bioinformatics Tool for AS3MT Antibody (NBP1-85354)

Discover related pathways, diseases and genes to AS3MT Antibody (NBP1-85354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AS3MT Antibody (NBP1-85354)

Discover more about diseases related to AS3MT Antibody (NBP1-85354).
 

Pathways for AS3MT Antibody (NBP1-85354)

View related products by pathway.

PTMs for AS3MT Antibody (NBP1-85354)

Learn more about PTMs related to AS3MT Antibody (NBP1-85354).
 

Research Areas for AS3MT Antibody (NBP1-85354)

Find related products by research area.

Blogs on AS3MT

There are no specific blogs for AS3MT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AS3MT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AS3MT