AS3MT Antibody

Images

 
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human breast shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human colon shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AS3MT Antibody [NBP1-85354] - Staining in human parathyroid gland and colon tissues. Corresponding AS3MT RNA-seq data are presented for the same tissues.

Product Details

Summary
Product Discontinued
View other related AS3MT Primary Antibodies

Order Details


    • Catalog Number
      NBP1-85354
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AS3MT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILK
Specificity
Specificity of human AS3MT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AS3MT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AS3MT Antibody

  • Arsenic (+3 Oxidation State) Methyltransferase
  • Arsenic Methyltransferase
  • arsenite methyltransferase
  • AS3MT
  • CYT19
  • CYT19methyltransferase cyt19
  • EC 2.1.1.137
  • Methylarsonite Methyltransferase
  • Methyltransferase Cyt19
  • S-Adenosyl-L-Methionine:Arsenic(III) Methyltransfe
  • S-adenosyl-L-methionine:arsenic(III) methyltransferase
  • S-Adenosylmethionine:Arsenic (III) Methyltransfera
  • S-adenosylmethionine:arsenic (III) methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-55515
Species: Hu
Applications: ICC/IF
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-56486
Species: Hu, Mu
Applications: WB
NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-65123
Species: Hu
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85354
Species: Hu
Applications: IHC, IHC-P

Publications for AS3MT Antibody (NBP1-85354) (0)

There are no publications for AS3MT Antibody (NBP1-85354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AS3MT Antibody (NBP1-85354) (0)

There are no reviews for AS3MT Antibody (NBP1-85354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AS3MT Antibody (NBP1-85354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AS3MT Products

Bioinformatics Tool for AS3MT Antibody (NBP1-85354)

Discover related pathways, diseases and genes to AS3MT Antibody (NBP1-85354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AS3MT Antibody (NBP1-85354)

Discover more about diseases related to AS3MT Antibody (NBP1-85354).
 

Pathways for AS3MT Antibody (NBP1-85354)

View related products by pathway.

PTMs for AS3MT Antibody (NBP1-85354)

Learn more about PTMs related to AS3MT Antibody (NBP1-85354).
 

Research Areas for AS3MT Antibody (NBP1-85354)

Find related products by research area.

Blogs on AS3MT

There are no specific blogs for AS3MT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AS3MT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AS3MT
Entrez