Arylsulfatase A/ARSA Antibody


Western Blot: ARSA Antibody [NBP1-54400] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Product Details

Product Discontinued
View other related Arylsulfatase A/ARSA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Arylsulfatase A/ARSA Antibody Summary

Synthetic peptides corresponding to ARSA(arylsulfatase A) The peptide sequence was selected from the middle region of ARSA. Peptide sequence KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARSA and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Arylsulfatase A/ARSA Antibody

  • ARSA
  • Arylsulfatase A
  • ASA
  • Cerebroside 3-sulfatase
  • Cerebroside-sulfatase
  • EC 3.1.6
  • EC
  • MLD


ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu

Publications for Arylsulfatase A/ARSA Antibody (NBP1-54400) (0)

There are no publications for Arylsulfatase A/ARSA Antibody (NBP1-54400).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arylsulfatase A/ARSA Antibody (NBP1-54400) (0)

There are no reviews for Arylsulfatase A/ARSA Antibody (NBP1-54400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arylsulfatase A/ARSA Antibody (NBP1-54400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Arylsulfatase A/ARSA Products

Bioinformatics Tool for Arylsulfatase A/ARSA Antibody (NBP1-54400)

Discover related pathways, diseases and genes to Arylsulfatase A/ARSA Antibody (NBP1-54400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arylsulfatase A/ARSA Antibody (NBP1-54400)

Discover more about diseases related to Arylsulfatase A/ARSA Antibody (NBP1-54400).

Pathways for Arylsulfatase A/ARSA Antibody (NBP1-54400)

View related products by pathway.

PTMs for Arylsulfatase A/ARSA Antibody (NBP1-54400)

Learn more about PTMs related to Arylsulfatase A/ARSA Antibody (NBP1-54400).

Research Areas for Arylsulfatase A/ARSA Antibody (NBP1-54400)

Find related products by research area.

Blogs on Arylsulfatase A/ARSA

There are no specific blogs for Arylsulfatase A/ARSA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Arylsulfatase A/ARSA Antibody and receive a gift card or discount.


Gene Symbol ARSA