ARS2 Antibody


Western Blot: ARS2 Antibody [NBP2-58433] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ARS2 Antibody [NBP2-58433] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

ARS2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF
Specificity of human ARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARS2 Recombinant Protein Antigen (NBP2-58433PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ARS2 Antibody

  • ARS2serrate
  • arsenate resistance protein 2
  • arsenate resistance protein ARS2
  • arsenite resistance protein
  • Arsenite-resistance protein 2
  • ASR2
  • MGC126427
  • serrate RNA effector molecule homolog (Arabidopsis)
  • serrate RNA effector molecule homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Mu
Applications: WB, Block
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, ChIP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARS2 Antibody (NBP2-58433) (0)

There are no publications for ARS2 Antibody (NBP2-58433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARS2 Antibody (NBP2-58433) (0)

There are no reviews for ARS2 Antibody (NBP2-58433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARS2 Antibody (NBP2-58433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ARS2 Antibody (NBP2-58433)

Discover related pathways, diseases and genes to ARS2 Antibody (NBP2-58433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARS2 Antibody (NBP2-58433)

Discover more about diseases related to ARS2 Antibody (NBP2-58433).

Pathways for ARS2 Antibody (NBP2-58433)

View related products by pathway.

PTMs for ARS2 Antibody (NBP2-58433)

Learn more about PTMs related to ARS2 Antibody (NBP2-58433).

Blogs on ARS2

There are no specific blogs for ARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARS2 Antibody and receive a gift card or discount.


Gene Symbol SRRT