Recombinant Human ARP10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARP10 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 182 of Human APOBEC3H full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
APOBEC3H
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARP10 Protein

  • APOBEC-related protein 10
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
  • ARP-10
  • ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
  • DNA dC->dU-editing enzyme APOBEC-3H
  • EC 3.5.4.-

Background

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP1-57372
Species: Hu
Applications: WB
NBP2-57602
Species: Hu
Applications: ICC/IF
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57440
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
H00057180-B01P
Species: Hu
Applications: WB, ELISA
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
H00164668-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARP10 Recombinant Protein (H00164668-P01) (0)

There are no publications for ARP10 Recombinant Protein (H00164668-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARP10 Recombinant Protein (H00164668-P01) (0)

There are no reviews for ARP10 Recombinant Protein (H00164668-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARP10 Recombinant Protein (H00164668-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARP10 Products

Bioinformatics Tool for ARP10 Recombinant Protein (H00164668-P01)

Discover related pathways, diseases and genes to ARP10 Recombinant Protein (H00164668-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARP10 Recombinant Protein (H00164668-P01)

Discover more about diseases related to ARP10 Recombinant Protein (H00164668-P01).
 

Pathways for ARP10 Recombinant Protein (H00164668-P01)

View related products by pathway.

PTMs for ARP10 Recombinant Protein (H00164668-P01)

Learn more about PTMs related to ARP10 Recombinant Protein (H00164668-P01).

Blogs on ARP10

There are no specific blogs for ARP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARP10 Antibody
NBP1-91682
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARP10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3H