ARP10 Antibody

Images

 
Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in ...read more
Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human tonsil shows strong cytoplasmic positivity in rare non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
Specificity
Specificity of human ARP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27650891). WB reported in the scientific literature (PMID: 25411794). WB reported in a verified customer review.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-91682 in the following applications:

Publications
Read Publications using
NBP1-91682 in the following applications:

  • 4 publications
  • WB
    4 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARP10 Antibody

  • APOBEC-related protein 10
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
  • ARP-10
  • ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
  • DNA dC->dU-editing enzyme APOBEC-3H
  • EC 3.5.4.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88592
Species: Hu
Applications: IHC, IHC-P
NBP1-57516
Species: Hu, Rt, Po, Bv, Eq, Rb, Ze
Applications: WB
NBP1-57372
Species: Hu
Applications: WB
NBP2-14875
Species: Hu
Applications: WB, IP
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57440
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N
NBP1-56569
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57469
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP1-91682
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARP10 Antibody (NBP1-91682)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(4)
WB
(4)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-91682 Applications Species
Ebrahimi D, Richards CM, Carpenter MA et al. Genetic and mechanistic basis for APOBEC3H alternative splicing, retrovirus restriction, and counteraction by HIV-1 protease. Nat Commun. Oct 8 2018 [PMID: 30297863] (WB, Human) WB Human
Salamango DJ, Becker JT, McCann JL et al. APOBEC3H Subcellular Localization Determinants Define Zipcode for Targeting HIV-1 for Restriction. Mol. Cell. Biol. Sep 17 2018 [PMID: 30224517] (ICC/IF, Human) ICC/IF Human
Shaban Na, Shi-k, Lauer-k et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism. Mol. Cell [PMID: 29290613] (WB, ICC/IF, Human) WB, ICC/IF Human
Shaban Na, Shi-k, Lauer-k et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by a RNA-Mediated Dimerization Mechanism. bioRxiv. [PMID: 29290613] (WB, ICC/IF, Human) WB, ICC/IF Human
Ooms M, Letko M, Simon V. The Structural Interface between HIV-1 Vif and Human APOBEC3H. J Virol 2017 Mar 01 [PMID: 28031368]
Starrett GJ, Luengas EM, McCann JL et al. The DNA cytosine deaminase APOBEC3H haplotype I likely contributes to breast and lung cancer mutagenesis Nat Commun Sep 21 2016 [PMID: 27650891] (ICC/IF, Human) ICC/IF Human
Refsland Ew, Hultquist Jf, Luengas Em et al. Natural Polymorphisms in Human APOBEC3H and HIV-1 Vif Combine in Primary T Lymphocytes to Affect Viral G-to-A Mutation Levels and Infectivity. PLoS Genet. 2014 Nov 01 [PMID: 25411794] (WB, Human) WB Human

Review for ARP10 Antibody (NBP1-91682) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91682:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ARP10 NBP1-91682
Enlarge
reviewed by:
Michael Carpenter
WB Human 11/17/2017
View

Summary

ApplicationWestern Blot
Sample Tested293T and MCF-7 cell lysates
SpeciesHuman
LotA96432

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARP10 Antibody (NBP1-91682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARP10 Products

Bioinformatics Tool for ARP10 Antibody (NBP1-91682)

Discover related pathways, diseases and genes to ARP10 Antibody (NBP1-91682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARP10 Antibody (NBP1-91682)

Discover more about diseases related to ARP10 Antibody (NBP1-91682).
 

Pathways for ARP10 Antibody (NBP1-91682)

View related products by pathway.

PTMs for ARP10 Antibody (NBP1-91682)

Learn more about PTMs related to ARP10 Antibody (NBP1-91682).

Blogs on ARP10

There are no specific blogs for ARP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Michael Carpenter
11/17/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol APOBEC3H
Entrez
Uniprot