ARNT/HIF-1 beta Antibody (1F12)

Images

 
Sandwich ELISA: ARNT/HIF-1 beta Antibody (1F12) [H00000405-M02] - Detection limit for recombinant GST tagged ARNT is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARNT/HIF-1 beta Antibody (1F12) Summary

Immunogen
ARNT (AAH60838, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT
Specificity
ARNT - aryl hydrocarbon receptor nuclear translocator (1F12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARNT
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARNT/HIF-1 beta Antibody (1F12)

  • ARNT protein
  • ARNT
  • aryl hydrocarbon receptor nuclear translocator
  • BHLHE2
  • HIF1 beta
  • HIF-1 beta
  • HIF1B
  • HIF1BETA
  • HIF-1-beta
  • HIF1-beta
  • hypoxia-inducible factor 1, beta subunit
  • Hypoxia-inducible factor 1-beta
  • nuclear translocator
  • TANGO

Background

The aryl hydrocarbon (Ah) receptor is involved in the induction of several enzymes that participate in xenobiotic metabolism. The ligand-free, cytosolic form of the Ah receptor is complexed to heat shock protein 90. Binding of ligand, which includes dioxin and polycyclic aromatic hydrocarbons, results in translocation of the ligand-binding subunit only to the nucleus. Induction of enzymes involved in xenobiotic metabolism occurs through binding of the ligand-bound Ah receptor to xenobiotic responsive elements in the promoters of genes for these enzymes. This gene encodes a protein that forms a complex with the ligand-bound Ah receptor, and is required for receptor function. The encoded protein has also been identified as the beta subunit of a heterodimeric transcription factor, hypoxia-inducible factor 1 (HIF1). A t(1;12)(q21;p13) translocation, which results in a TEL-ARNT fusion protein, is associated with acute myeloblastic leukemia. Three alternatively spliced variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057491-R01
Species: Hu
NBP1-88623
Species: Hu
Applications: IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000405-M02
Species: Hu
Applications: WB, ELISA

Publications for ARNT/HIF-1 beta Antibody (H00000405-M02) (0)

There are no publications for ARNT/HIF-1 beta Antibody (H00000405-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNT/HIF-1 beta Antibody (H00000405-M02) (0)

There are no reviews for ARNT/HIF-1 beta Antibody (H00000405-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNT/HIF-1 beta Antibody (H00000405-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARNT/HIF-1 beta Products

Bioinformatics Tool for ARNT/HIF-1 beta Antibody (H00000405-M02)

Discover related pathways, diseases and genes to ARNT/HIF-1 beta Antibody (H00000405-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNT/HIF-1 beta Antibody (H00000405-M02)

Discover more about diseases related to ARNT/HIF-1 beta Antibody (H00000405-M02).
 

Pathways for ARNT/HIF-1 beta Antibody (H00000405-M02)

View related products by pathway.

PTMs for ARNT/HIF-1 beta Antibody (H00000405-M02)

Learn more about PTMs related to ARNT/HIF-1 beta Antibody (H00000405-M02).
 

Research Areas for ARNT/HIF-1 beta Antibody (H00000405-M02)

Find related products by research area.

Blogs on ARNT/HIF-1 beta.

HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions
HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt...  Read full blog post.

HIF-3 alpha: a versatile target with hypoxia dependent and independent functions
By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon...  Read full blog post.

HIF-1 beta - activating gene transcription in response to hypoxia
Hypoxia-inducible factor 1 (HIF-1) is a heterodimeric transcription factor consisting of alpha and beta subunits. The levels of functional HIF-1 in the cell depends on the level of oxygen allowing cells to respond to hypoxic conditions. HIF-1a is a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNT/HIF-1 beta Antibody (1F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNT
Entrez