ARMCX3 Antibody

Images

 
Western Blot: ARMCX3 Antibody [NBP1-69592] - This Anti-ARMCX3 antibody was used in Western Blot of Fetal Spleen tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related ARMCX3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69592
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARMCX3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARMCX3(armadillo repeat containing, X-linked 3) The peptide sequence was selected from the middle region of ARMCX3. Peptide sequence LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE.
Clonality
Polyclonal
Host
Rabbit
Gene
ARMCX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARMCX3 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARMCX3 Antibody

  • ALEX3arm protein lost in epithelial cancers, X chromosome, 3
  • ARM protein lost in epithelial cancers on chromosome X 3
  • armadillo repeat containing, X-linked 3
  • armadillo repeat-containing X-linked protein 3,1200004E24Rik
  • dJ545K15.2
  • DKFZp781N1954
  • KIAA0443
  • MGC12199
  • Protein ALEX3

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89144
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2864
Species: Hu
Applications: WB, ICC
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-129
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA

Publications for ARMCX3 Antibody (NBP1-69592) (0)

There are no publications for ARMCX3 Antibody (NBP1-69592).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX3 Antibody (NBP1-69592) (0)

There are no reviews for ARMCX3 Antibody (NBP1-69592). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMCX3 Antibody (NBP1-69592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMCX3 Products

Bioinformatics Tool for ARMCX3 Antibody (NBP1-69592)

Discover related pathways, diseases and genes to ARMCX3 Antibody (NBP1-69592). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMCX3 Antibody (NBP1-69592)

Discover more about diseases related to ARMCX3 Antibody (NBP1-69592).
 

Pathways for ARMCX3 Antibody (NBP1-69592)

View related products by pathway.

Blogs on ARMCX3

There are no specific blogs for ARMCX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMCX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX3
Uniprot