ARL11 Antibody


Western Blot: ARL11 Antibody [NBP1-55406] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Product Discontinued
View other related ARL11 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARL11 Antibody Summary

Synthetic peptides corresponding to ARL11(ADP-ribosylation factor-like 11) The peptide sequence was selected from the middle region of ARL11. Peptide sequence WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARL11 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARL11 Antibody

  • ADP-ribosylation factor-like 11
  • ADP-ribosylation factor-like protein 11
  • ADP-ribosylation factor-like tumor suppressor protein 1
  • ARLTS1FLJ33930
  • MGC17429


ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ARL11 Antibody (NBP1-55406) (0)

There are no publications for ARL11 Antibody (NBP1-55406).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL11 Antibody (NBP1-55406) (0)

There are no reviews for ARL11 Antibody (NBP1-55406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL11 Antibody (NBP1-55406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARL11 Products

Bioinformatics Tool for ARL11 Antibody (NBP1-55406)

Discover related pathways, diseases and genes to ARL11 Antibody (NBP1-55406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL11 Antibody (NBP1-55406)

Discover more about diseases related to ARL11 Antibody (NBP1-55406).

Pathways for ARL11 Antibody (NBP1-55406)

View related products by pathway.

PTMs for ARL11 Antibody (NBP1-55406)

Learn more about PTMs related to ARL11 Antibody (NBP1-55406).

Research Areas for ARL11 Antibody (NBP1-55406)

Find related products by research area.

Blogs on ARL11

There are no specific blogs for ARL11, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARL11 Antibody and receive a gift card or discount.


Gene Symbol ARL11