ARIH2 Antibody

Images

 
Western Blot: ARIH2 Antibody [NBP1-69108] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ARIH2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69108
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARIH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARIH2 (ariadne homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of ARIH2. Peptide sequence MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG.
Clonality
Polyclonal
Host
Rabbit
Gene
ARIH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARIH2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARIH2 Antibody

  • ARI-2
  • ariadne (Drosophila) homolog 2
  • ariadne homolog 2 (Drosophila)
  • E3 ubiquitin-protein ligase ARIH2
  • EC 6.3.2.-
  • FLJ10938
  • FLJ33921
  • Protein ariadne-2 homolog
  • Triad1 protein
  • TRIAD1ARI2all-trans retinoic acid inducible RING finger

Background

ARIH2 is the E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. 'ARIH2 may play a role in myelopoiesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56357
Species: Hu
Applications: WB, IP
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-93596
Species: Hu, Rt, Po, Dr, Ze, Mu(-)
Applications: WB, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP2-07900
Species: Hu
NBP1-69108
Species: Hu
Applications: WB

Publications for ARIH2 Antibody (NBP1-69108) (0)

There are no publications for ARIH2 Antibody (NBP1-69108).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARIH2 Antibody (NBP1-69108) (0)

There are no reviews for ARIH2 Antibody (NBP1-69108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARIH2 Antibody (NBP1-69108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARIH2 Products

Bioinformatics Tool for ARIH2 Antibody (NBP1-69108)

Discover related pathways, diseases and genes to ARIH2 Antibody (NBP1-69108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARIH2 Antibody (NBP1-69108)

Discover more about diseases related to ARIH2 Antibody (NBP1-69108).
 

Pathways for ARIH2 Antibody (NBP1-69108)

View related products by pathway.

PTMs for ARIH2 Antibody (NBP1-69108)

Learn more about PTMs related to ARIH2 Antibody (NBP1-69108).

Blogs on ARIH2

There are no specific blogs for ARIH2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARIH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARIH2