ARHGEF15 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGEF15 Antibody [NBP1-91679] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related ARHGEF15 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-91679
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARHGEF15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTHRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCDCSQELCSESSAPAKTEGRSLESRAAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEH
Specificity
Specificity of human ARHGEF15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF15 Antibody

  • ARGEF15Rho GEF 15
  • E5
  • Ephexin5
  • Ephexin-5
  • FLJ13791
  • KIAA0915Vsm-RhoGEFephexin-5
  • MGC44868
  • Rho guanine exchange factor (GEF) 15
  • Rho guanine nucleotide exchange factor (GEF) 15
  • rho guanine nucleotide exchange factor 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20116
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ARHGEF15 Antibody (NBP1-91679) (0)

There are no publications for ARHGEF15 Antibody (NBP1-91679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF15 Antibody (NBP1-91679) (0)

There are no reviews for ARHGEF15 Antibody (NBP1-91679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGEF15 Antibody (NBP1-91679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF15 Products

Bioinformatics Tool for ARHGEF15 Antibody (NBP1-91679)

Discover related pathways, diseases and genes to ARHGEF15 Antibody (NBP1-91679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF15 Antibody (NBP1-91679)

Discover more about diseases related to ARHGEF15 Antibody (NBP1-91679).
 

Pathways for ARHGEF15 Antibody (NBP1-91679)

View related products by pathway.

Blogs on ARHGEF15

There are no specific blogs for ARHGEF15, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF15
Entrez
Uniprot