ARHGAP28 Antibody


Western Blot: ARHGAP28 Antibody [NBP1-56399] - Human Fetal Lung lysate, concentration 0.2-1 ug/ml.
Western Blot: ARHGAP28 Antibody [NBP1-56399] - Human 721_B, Antibody Dilution: 1.0 ug/ml ARHGAP28 is supported by BioGPS gene expression data to be expressed in 721_B.

Product Details

Product Discontinued
View other related ARHGAP28 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARHGAP28 Antibody Summary

Synthetic peptides corresponding to ARHGAP28(Rho GTPase activating protein 28) The peptide sequence was selected from the C terminal of ARHGAP28. Peptide sequence AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARHGAP28 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARHGAP28 Antibody

  • DKFZp686A2038
  • FLJ10312
  • KIAA1314FLJ27160
  • Rho GTPase activating protein 28
  • rho GTPase-activating protein 28
  • Rho-type GTPase-activating protein 28


ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP28 Antibody (NBP1-56399) (0)

There are no publications for ARHGAP28 Antibody (NBP1-56399).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP28 Antibody (NBP1-56399) (0)

There are no reviews for ARHGAP28 Antibody (NBP1-56399). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP28 Antibody (NBP1-56399) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ARHGAP28 Antibody (NBP1-56399)

Discover related pathways, diseases and genes to ARHGAP28 Antibody (NBP1-56399). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP28 Antibody (NBP1-56399)

Discover more about diseases related to ARHGAP28 Antibody (NBP1-56399).

Pathways for ARHGAP28 Antibody (NBP1-56399)

View related products by pathway.

Blogs on ARHGAP28

There are no specific blogs for ARHGAP28, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARHGAP28 Antibody and receive a gift card or discount.


Gene Symbol ARHGAP28