ARHGAP25 Antibody

Images

 
Western Blot: ARHGAP25 Antibody [NBP1-55219] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ARHGAP25 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55219
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARHGAP25 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARHGAP25(Rho GTPase activating protein 25) The peptide sequence was selected from the middle region of ARHGAP25. Peptide sequence SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL.
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARHGAP25 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARHGAP25 Antibody

  • KAIA0053
  • KIAA0053
  • Rho GTPase activating protein 25
  • rho GTPase-activating protein 25
  • Rho-type GTPase-activating protein 25

Background

ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44073
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55219
Species: Hu
Applications: WB

Publications for ARHGAP25 Antibody (NBP1-55219) (0)

There are no publications for ARHGAP25 Antibody (NBP1-55219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP25 Antibody (NBP1-55219) (0)

There are no reviews for ARHGAP25 Antibody (NBP1-55219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP25 Antibody (NBP1-55219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARHGAP25 Antibody (NBP1-55219)

Discover related pathways, diseases and genes to ARHGAP25 Antibody (NBP1-55219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP25 Antibody (NBP1-55219)

Discover more about diseases related to ARHGAP25 Antibody (NBP1-55219).
 

Pathways for ARHGAP25 Antibody (NBP1-55219)

View related products by pathway.

PTMs for ARHGAP25 Antibody (NBP1-55219)

Learn more about PTMs related to ARHGAP25 Antibody (NBP1-55219).

Blogs on ARHGAP25

There are no specific blogs for ARHGAP25, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP25