Argininosuccinate Lyase Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Argininosuccinate Lyase Recombinant Protein Summary

Description
Argininosuccinate Lyase (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAELLFWASLCMTHLSRMAEDLILYCTKEFSFVQPSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Gene
ASL

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 4
using
H00000435-P01 in the following application:

Reactivity Notes

Human, e. coli

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Argininosuccinate Lyase Recombinant Protein

  • argininosuccinase
  • argininosuccinate lyase
  • arginosuccinase
  • ASAL
  • EC 4.3.2.1

Background

ASL( AAH08195, 1 a.a. - 465 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37520
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-605
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: ICC, ICFlow
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-79444
Species: Hu
Applications: WB
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9028
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000435-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Argininosuccinate Lyase Recombinant Protein (H00000435-P01) (0)

There are no publications for Argininosuccinate Lyase Recombinant Protein (H00000435-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Argininosuccinate Lyase Recombinant Protein (H00000435-P01) (1) 41

Average Rating: 4
(Based on 1 reviews)
We have 1 review tested in 1 species: Other.
We have 1 review tested in 1 application: WB.

Reviews using H00000435-P01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Other 03/03/2009
View

Summary

ApplicationWestern Blot
Sample Testedecoli, Sample Amount: 0.5 ug
SpeciesOther
Lot0970717

Blocking

Blocking DetailsBlocking Buffer: 5% blotto, Blocking Time: 45 minutes, Blocking Temp: 25 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1/2000, Incubation Dilution Buffer: 2.5% blotto, Incubation Time: 45 minutes, Incubation Temp: 25 C

Secondary Antibody

Secondary DescriptionSecondary Ab: rabbit anti mouse pAb HRP, Secondary Ab Dilution Ratio: 1/10000

Details

Detection NotesDetection Method: ECL, Exposure Time: 1 minute, Specific Bands: 50 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argininosuccinate Lyase Recombinant Protein (H00000435-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Argininosuccinate Lyase Products

Related Products by Gene

Bioinformatics Tool for Argininosuccinate Lyase Recombinant Protein (H00000435-P01)

Discover related pathways, diseases and genes to Argininosuccinate Lyase Recombinant Protein (H00000435-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Lyase Recombinant Protein (H00000435-P01)

Discover more about diseases related to Argininosuccinate Lyase Recombinant Protein (H00000435-P01).
 

Pathways for Argininosuccinate Lyase Recombinant Protein (H00000435-P01)

View related products by pathway.

PTMs for Argininosuccinate Lyase Recombinant Protein (H00000435-P01)

Learn more about PTMs related to Argininosuccinate Lyase Recombinant Protein (H00000435-P01).

Blogs on Argininosuccinate Lyase

There are no specific blogs for Argininosuccinate Lyase, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ASL

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00000435-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought