Argininosuccinate Lyase Antibody (4C5-1F2) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Argininosuccinate Lyase Primary Antibodies

Order Details


    • Catalog Number
      H00000435-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Argininosuccinate Lyase Antibody (4C5-1F2) [DyLight 405] Summary

Immunogen
ASL (AAH08195, 1 a.a. ~ 465 a.a) full length recombinant protein with GST tag.MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGS KAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSN DEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMR QTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIR WSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFW
Specificity
ASL - argininosuccinate lyase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Format
DyLight 405 (A=400, E=420)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in Rat reported in customer review. H00000435-M01has been used successfully in immunohistochemistry on frozen sections as reported by a customer review.

Reactivity Notes

Rat reported in customer review.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Argininosuccinate Lyase Antibody (4C5-1F2) [DyLight 405]

  • argininosuccinase
  • argininosuccinate lyase
  • arginosuccinase
  • ASAL
  • EC 4.3.2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37520
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-605
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: ICC, ICFlow
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-79444
Species: Hu
Applications: WB
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9028
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000435-M01V
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr

Publications for Argininosuccinate Lyase Antibody (H00000435-M01V) (0)

There are no publications for Argininosuccinate Lyase Antibody (H00000435-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Argininosuccinate Lyase Antibody (H00000435-M01V) (0)

There are no reviews for Argininosuccinate Lyase Antibody (H00000435-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Argininosuccinate Lyase Antibody (H00000435-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Argininosuccinate Lyase Products

Related Products by Gene

Bioinformatics Tool for Argininosuccinate Lyase Antibody (H00000435-M01V)

Discover related pathways, diseases and genes to Argininosuccinate Lyase Antibody (H00000435-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Lyase Antibody (H00000435-M01V)

Discover more about diseases related to Argininosuccinate Lyase Antibody (H00000435-M01V).
 

Pathways for Argininosuccinate Lyase Antibody (H00000435-M01V)

View related products by pathway.

PTMs for Argininosuccinate Lyase Antibody (H00000435-M01V)

Learn more about PTMs related to Argininosuccinate Lyase Antibody (H00000435-M01V).

Blogs on Argininosuccinate Lyase

There are no specific blogs for Argininosuccinate Lyase, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ASL

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00000435-M01V below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.