ARFIP1 Antibody

Images

 
Western Blot: ARFIP1 Antibody [NBP1-69162] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ARFIP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69162
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARFIP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARFIP1 (ADP-ribosylation factor interacting protein 1) The peptide sequence was selected from the C terminal of ARFIP1 (NP_001020766). Peptide sequence NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL.
Clonality
Polyclonal
Host
Rabbit
Gene
ARFIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARFIP1 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARFIP1 Antibody

  • ADP-ribosylation factor interacting protein 1
  • ADP-ribosylation factor-interacting protein 1
  • arfaptin 1
  • arfaptin-1
  • HSU52521
  • MGC117369

Background

ARFIP1 is a putative target protein of ADP-ribosylation factor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87255
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
H00000381-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-69162
Species: Hu
Applications: WB

Publications for ARFIP1 Antibody (NBP1-69162) (0)

There are no publications for ARFIP1 Antibody (NBP1-69162).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFIP1 Antibody (NBP1-69162) (0)

There are no reviews for ARFIP1 Antibody (NBP1-69162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARFIP1 Antibody (NBP1-69162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFIP1 Products

Bioinformatics Tool for ARFIP1 Antibody (NBP1-69162)

Discover related pathways, diseases and genes to ARFIP1 Antibody (NBP1-69162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFIP1 Antibody (NBP1-69162)

Discover more about diseases related to ARFIP1 Antibody (NBP1-69162).
 

Pathways for ARFIP1 Antibody (NBP1-69162)

View related products by pathway.

PTMs for ARFIP1 Antibody (NBP1-69162)

Learn more about PTMs related to ARFIP1 Antibody (NBP1-69162).

Blogs on ARFIP1

There are no specific blogs for ARFIP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFIP1
Entrez
Uniprot