ARF5 Antibody (1B4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ARF5 Primary Antibodies

Order Details


    • Catalog Number
      H00000381-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARF5 Antibody (1B4) [DyLight 488] Summary

Immunogen
ARF5 (AAH03043, 81 a.a. - 180 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Specificity
ARF5 - ADP-ribosylation factor 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARF5 Antibody (1B4) [DyLight 488]

  • ADP-ribosylation factor 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-26147
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-32606
Species: Mu
Applications: IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2420
Species: Hu
Applications: WB, IHC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011247-T01
Species: Hu
NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00000381-M01G
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for ARF5 Antibody (H00000381-M01G) (0)

There are no publications for ARF5 Antibody (H00000381-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARF5 Antibody (H00000381-M01G) (0)

There are no reviews for ARF5 Antibody (H00000381-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARF5 Antibody (H00000381-M01G). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each protein that won't cross react with the other protein?
    • I checked the sequence similarity between ARF4 and ARF5, and there is very high homology between the two proteins. We have not specifically tested our antibodies for cross-reactivity between the two, but I think it's likely that they will.

Secondary Antibodies

 

Isotype Controls

Additional ARF5 Products

Bioinformatics Tool for ARF5 Antibody (H00000381-M01G)

Discover related pathways, diseases and genes to ARF5 Antibody (H00000381-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF5 Antibody (H00000381-M01G)

Discover more about diseases related to ARF5 Antibody (H00000381-M01G).
 

Pathways for ARF5 Antibody (H00000381-M01G)

View related products by pathway.

PTMs for ARF5 Antibody (H00000381-M01G)

Learn more about PTMs related to ARF5 Antibody (H00000381-M01G).
 

Research Areas for ARF5 Antibody (H00000381-M01G)

Find related products by research area.

Blogs on ARF5

There are no specific blogs for ARF5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARF5 Antibody (1B4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ARF5