ARAP1 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

ARAP1 Partial Recombinant Protein Summary

Description
ARAP1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
Preparation
Method
in vitro wheat germ expression system
Gene
ARAP1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARAP1 Partial Recombinant Protein

  • arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  • centaurin, delta 2
  • Centaurin-delta-2
  • CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1
  • cnt-d2
  • KIAA0782centaurin-delta-2

Background

CENTD2 - centaurin, delta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31227
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60099
Species: Hu
Applications: WB, ICC/IF, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-90060
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no publications for ARAP1 Partial Recombinant Protein (H00116985-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no reviews for ARAP1 Partial Recombinant Protein (H00116985-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARAP1 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Discover related pathways, diseases and genes to ARAP1 Partial Recombinant Protein (H00116985-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Discover more about diseases related to ARAP1 Partial Recombinant Protein (H00116985-Q01).
 

Pathways for ARAP1 Partial Recombinant Protein (H00116985-Q01)

View related products by pathway.

PTMs for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Learn more about PTMs related to ARAP1 Partial Recombinant Protein (H00116985-Q01).
 

Research Areas for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Find related products by research area.

Blogs on ARAP1

There are no specific blogs for ARAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ARAP1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00116985-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

ARAP1 Recombinant Protein
H00116985-P01-10ug
ARAP1 Antibody
NB100-68223
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106