Recombinant Human ARAP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARAP1 Protein Summary

Description
ARAP1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARAP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARAP1 Protein

  • arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  • centaurin, delta 2
  • Centaurin-delta-2
  • CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1
  • cnt-d2
  • KIAA0782centaurin-delta-2

Background

CENTD2 - centaurin, delta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31227
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60099
Species: Hu
Applications: WB, ICC/IF, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-90060
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no publications for ARAP1 Partial Recombinant Protein (H00116985-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no reviews for ARAP1 Partial Recombinant Protein (H00116985-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARAP1 Partial Recombinant Protein (H00116985-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARAP1 Products

Bioinformatics Tool for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Discover related pathways, diseases and genes to ARAP1 Partial Recombinant Protein (H00116985-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Discover more about diseases related to ARAP1 Partial Recombinant Protein (H00116985-Q01).
 

Pathways for ARAP1 Partial Recombinant Protein (H00116985-Q01)

View related products by pathway.

PTMs for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Learn more about PTMs related to ARAP1 Partial Recombinant Protein (H00116985-Q01).
 

Research Areas for ARAP1 Partial Recombinant Protein (H00116985-Q01)

Find related products by research area.

Blogs on ARAP1

There are no specific blogs for ARAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARAP1 Antibody
NBP2-56429
ARAP1 Antibody
NBP2-56429
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARAP1