Aquaporin-4 Antibody

Images

 
Western Blot: Aquaporin-4 Antibody [NBP2-87019] - Host: Rabbit. Target Name: AQP4. Sample Tissue: Human A172 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aquaporin-4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Aquaporin-4. Peptide sequence: KAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AQP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aquaporin-4 Antibody

  • AQP4
  • AQP-4
  • Aquaporin 4
  • MGC22454
  • MIWC
  • WCH4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-92885
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67247
Species: Hu
Applications: ICC/IF, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-30865
Species: Hu
Applications: IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
DVE00
Species: Hu
Applications: ELISA
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-87019
Species: Hu
Applications: WB

Publications for Aquaporin-4 Antibody (NBP2-87019) (0)

There are no publications for Aquaporin-4 Antibody (NBP2-87019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-4 Antibody (NBP2-87019) (0)

There are no reviews for Aquaporin-4 Antibody (NBP2-87019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aquaporin-4 Antibody (NBP2-87019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aquaporin-4 Products

Bioinformatics Tool for Aquaporin-4 Antibody (NBP2-87019)

Discover related pathways, diseases and genes to Aquaporin-4 Antibody (NBP2-87019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-4 Antibody (NBP2-87019)

Discover more about diseases related to Aquaporin-4 Antibody (NBP2-87019).
 

Pathways for Aquaporin-4 Antibody (NBP2-87019)

View related products by pathway.

PTMs for Aquaporin-4 Antibody (NBP2-87019)

Learn more about PTMs related to Aquaporin-4 Antibody (NBP2-87019).
 

Research Areas for Aquaporin-4 Antibody (NBP2-87019)

Find related products by research area.

Blogs on Aquaporin-4

There are no specific blogs for Aquaporin-4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aquaporin-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP4