Recombinant Human APPBP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APPBP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 486-585 of Human APPBP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
APPBP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APPBP2 Protein

  • amyloid beta precursor protein (cytoplasmic tail) binding protein 2
  • Amyloid beta precursor protein-binding protein 2
  • amyloid protein-binding protein 2
  • APP-BP2
  • KIAA0228HS.84084
  • PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2
  • Protein interacting with APP tail 1

Background

APPBP2 - amyloid beta precursor protein (cytoplasmic tail) binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-47273
Species: Hu
Applications: IHC, IHC-P
NBP1-92401
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-41070
Species: Hu
Applications: WB, IP, PLA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-04891
Species: Hu
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
H00010513-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for APPBP2 Partial Recombinant Protein (H00010513-Q01) (0)

There are no publications for APPBP2 Partial Recombinant Protein (H00010513-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APPBP2 Partial Recombinant Protein (H00010513-Q01) (0)

There are no reviews for APPBP2 Partial Recombinant Protein (H00010513-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APPBP2 Partial Recombinant Protein (H00010513-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APPBP2 Products

Bioinformatics Tool for APPBP2 Partial Recombinant Protein (H00010513-Q01)

Discover related pathways, diseases and genes to APPBP2 Partial Recombinant Protein (H00010513-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APPBP2 Partial Recombinant Protein (H00010513-Q01)

Discover more about diseases related to APPBP2 Partial Recombinant Protein (H00010513-Q01).
 

Pathways for APPBP2 Partial Recombinant Protein (H00010513-Q01)

View related products by pathway.

Research Areas for APPBP2 Partial Recombinant Protein (H00010513-Q01)

Find related products by research area.

Blogs on APPBP2

There are no specific blogs for APPBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APPBP2 Antibody
NBP2-15432
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APPBP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APPBP2