APPBP2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit APPBP2 Antibody - BSA Free (NBP3-17802) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW |
| Predicted Species |
Mouse (100%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APPBP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
Retrieval method: HIER pH6 |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for APPBP2 Antibody - BSA Free
Background
APPBP2, or Amyloid protein-binding protein 2, consists of a 585 amino acid isoform that is 67 kDa, and is involved in protein transport and processing and the movement of certain molecules along microtubules. Research is currently being conducted with regards to APPBP2 and its relation to breast cancer, Alzheimer's disease, and herpes simplex. The protein has been linked to the regulation of Androgen receptors, and interacts with HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, and HIST1H3E.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IP, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for APPBP2 Antibody (NBP3-17802) (0)
There are no publications for APPBP2 Antibody (NBP3-17802).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APPBP2 Antibody (NBP3-17802) (0)
There are no reviews for APPBP2 Antibody (NBP3-17802).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for APPBP2 Antibody (NBP3-17802) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APPBP2 Products
Research Areas for APPBP2 Antibody (NBP3-17802)
Find related products by research area.
|
Blogs on APPBP2