APPBP2 Antibody


Western Blot: APPBP2 Antibody [NBP1-53085] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

APPBP2 Antibody Summary

Synthetic peptides corresponding to Amyloid precursor protein (cytoplasmic tail) binding protein 2) The peptide sequence was selected from the middle region of Amyloid precursor protein (NP_006371). Peptide sequence: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APPBP2 Antibody

  • amyloid beta precursor protein (cytoplasmic tail) binding protein 2
  • Amyloid beta precursor protein-binding protein 2
  • amyloid protein-binding protein 2
  • APP-BP2
  • KIAA0228HS.84084
  • PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2
  • Protein interacting with APP tail 1


Amyloid Precursor Protein (APP) functions as a cell surface kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. APP is important for neurite growth, neuronal adhesion and axonogenesis. Immature APP (N-glycosylated in the endoplasmic reticulum) moves to the Golgi complex where complete maturation occurs (O-glycosylated and sulfated). After alpha-secretase cleavage, soluble APP is released into the extracellular space and the C-terminal is internalized to endosomes and lysosomes. Some APP accumulates in secretory transport vesicles leaving the late Golgi compartment and returns to the cell surface. APP is expressed in the brain, kidney, heart and spleen of fetal tissues; it is induced during neuronal differentiation. In adult brain, highest expression of APP is found in the frontal lobe of the cortex and in the anterior perisylvian cortex-opercular gyri. Moderate expression in the cerebellar cortex, the posterior perisylvian cortex-opercular gyri and the temporal associated cortex. Defects in APP are a cause of autosomal dominant Alzheimer's disease (AD).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ze
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for APPBP2 Antibody (NBP1-53085) (0)

There are no publications for APPBP2 Antibody (NBP1-53085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APPBP2 Antibody (NBP1-53085) (0)

There are no reviews for APPBP2 Antibody (NBP1-53085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APPBP2 Antibody (NBP1-53085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional APPBP2 Products

Bioinformatics Tool for APPBP2 Antibody (NBP1-53085)

Discover related pathways, diseases and genes to APPBP2 Antibody (NBP1-53085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APPBP2 Antibody (NBP1-53085)

Discover more about diseases related to APPBP2 Antibody (NBP1-53085).

Pathways for APPBP2 Antibody (NBP1-53085)

View related products by pathway.

Blogs on APPBP2

There are no specific blogs for APPBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APPBP2 Antibody and receive a gift card or discount.


Gene Symbol APPBP2