APP Antibody


Western Blot: Amyloid Precursor Protein Antibody [NBP1-74184] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related APP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

APP Antibody Summary

Synthetic peptides corresponding to the C terminal of App. Immunizing peptide sequence LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against App and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APP Antibody

  • amyloid beta (A4) precursor protein-binding, family B, member 2
  • amyloid beta A4 precursor protein-binding family B member 2
  • Amyloid beta precursor protein
  • Amyloid beta
  • APP
  • beta Amyloid
  • Protease Nexin II


App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, PLA
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for APP Antibody (NBP1-74184) (0)

There are no publications for APP Antibody (NBP1-74184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APP Antibody (NBP1-74184) (0)

There are no reviews for APP Antibody (NBP1-74184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APP Antibody (NBP1-74184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional APP Products

Bioinformatics Tool for APP Antibody (NBP1-74184)

Discover related pathways, diseases and genes to APP Antibody (NBP1-74184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APP Antibody (NBP1-74184)

Discover more about diseases related to APP Antibody (NBP1-74184).

Pathways for APP Antibody (NBP1-74184)

View related products by pathway.

PTMs for APP Antibody (NBP1-74184)

Learn more about PTMs related to APP Antibody (NBP1-74184).

Blogs on APP.

Lysosomal Dysfunction is Linked to Exosomal Secretion
By Christina Towers, PhD. Lysosomal Dysfunction and DiseaseLysosomes are highly acidic organelles that are critical for cellular function and indispensable for degradative pathways like autophagy and endocytosis....  Read full blog post.

Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation
By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea...  Read full blog post.

The C99 fragment of amyloid precursor protein (APP)
Alzheimer’s Disease (AD) is a neurodegenerative disorder that is characterized by an abundance of the beta-amyloid peptide in the brain.  When AD was first discovered, it was determined that beta-amyloid was produced as a result of the prote...  Read full blog post.

Beta Amyloid (MOAB2) and the link between traumatic brain injury and Alzheimer’s disease
An epidemiological association between traumatic brain injury (TBI) and Alzheimer's disease (AD) has long been established.  Interestingly, an increase in beta amyloid  (one hallmark of AD) directly following TBI has been observed.  In fact, it h...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Beta Amyloid Neurotoxicity and Alzheimer's Disease
A major histopathological hallmark of Alzheimer's disease (AD) is the presence of amyloid deposits in the parenchyma of the amygdala, hippocampus, and neocortex. The principal component of amyloid is beta amyloid (AB). The pathologic accumulation of A...  Read full blog post.

ApoE: The Key to Preventing Alzheimer's Disease?
Apolipoprotein E also known as ApoE is a 36kDa protein that is expressed in all lipoprotein fractions in plasma. This protein is produced in high quantities in the liver, brain, spleen, lung and kidney. The function of APOE is to mediate the binding,...  Read full blog post.

Amyloid beta and Methionine Sulfoxide Related to Abeta 42 Antibody and Abeta 40 Antibody
By Eric NeeleyAlzheimer's disease is a devastating neurodegenerative illness characterized by the formation of plaques, tangles, and eventually synaptic loss. Amyloid beta (A beta ) is the processed form of the Amyloid precursor protein (APP), and whose...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APP Antibody and receive a gift card or discount.


Gene Symbol APP