APP Antibody

Product Details

Product Discontinued
View other related APP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

APP Antibody Summary

Synthetic peptides corresponding to the C terminal of App. Immunizing peptide sequence LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified

Application Notes
This is a rabbit polyclonal antibody against App and was validated on Western blot.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu
Applications: WB
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Av, Bv, Sh
Applications: WB
Species: Mu
Applications: WB

Publications for APP Antibody (NBP1-74184) (0)

There are no publications for APP Antibody (NBP1-74184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APP Antibody (NBP1-74184) (0)

There are no reviews for APP Antibody (NBP1-74184). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for APP Antibody (NBP1-74184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APP Antibody Products

Related Products by Gene

Bioinformatics Tool for APP Antibody (NBP1-74184)

Discover related pathways, diseases and genes to APP Antibody (NBP1-74184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APP Antibody (NBP1-74184)

Discover more about diseases related to APP Antibody (NBP1-74184).

Pathways for APP Antibody (NBP1-74184)

View related products by pathway.

PTMs for APP Antibody (NBP1-74184)

Learn more about PTMs related to APP Antibody (NBP1-74184).

Blogs on APP.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Beta Amyloid Neurotoxicity and Alzheimer's Disease
A major histopathological hallmark of Alzheimer's disease (AD) is the presence of amyloid deposits in the parenchyma of the amygdala, hippocampus, and neocortex. The principal component of amyloid is beta amyloid (AB). The pathologic accumulation of A...  Read full blog post.

ApoE: The Key to Preventing Alzheimer's Disease?
Apolipoprotein E also known as ApoE is a 36kDa protein that is expressed in all lipoprotein fractions in plasma. This protein is produced in high quantities in the liver, brain, spleen, lung and kidney. The function of APOE is to mediate the binding,...  Read full blog post.

Amyloid beta and Methionine Sulfoxide Related to Abeta 42 Antibody and Abeta 40 Antibody
By Eric NeeleyAlzheimer's disease is a devastating neurodegenerative illness characterized by the formation of plaques, tangles, and eventually synaptic loss. Amyloid beta (A beta ) is the processed form of the Amyloid precursor protein (APP), and whose...  Read full blog post.

Contact Information

Product PDFs

Gene Symbol APP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-74184 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.