Recombinant Human Apolipoprotein E R2/ApoE R2 Protein

Images

 

Order Details


    • Catalog Number
      H00007804-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Apolipoprotein E R2/ApoE R2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 83-170 of Human LRP8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LRP8

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM PB, 100 mM NaCl, pH 7.5

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein E R2/ApoE R2 Protein

  • ApoER2
  • APOER2HSZ75190
  • Apolipoprotein E R2
  • Apolipoprotein E receptor 2
  • low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
  • low-density lipoprotein receptor-related protein 8
  • Lr8b
  • LRP8
  • LRP-8
  • MCI1

Background

LRP8 - low density lipoprotein receptor-related protein 8, apolipoprotein e receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16095
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00007804-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01) (0)

There are no publications for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01) (0)

There are no reviews for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein E R2/ApoE R2 Products

Bioinformatics Tool for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01)

Discover related pathways, diseases and genes to Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01)

Discover more about diseases related to Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01).
 

Pathways for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01)

View related products by pathway.

PTMs for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01)

Learn more about PTMs related to Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01).
 

Research Areas for Apolipoprotein E R2/ApoE R2 Partial Recombinant Protein (H00007804-Q01)

Find related products by research area.

Blogs on Apolipoprotein E R2/ApoE R2

There are no specific blogs for Apolipoprotein E R2/ApoE R2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein E R2/ApoE R2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP8
Entrez