Apolipoprotein E R2/ApoE R2 Antibody


Western Blot: ApoER2 Antibody [NBP1-69114] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Apolipoprotein E R2/ApoE R2 Antibody Summary

Synthetic peptides corresponding to Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor) The peptide sequence was selected from the middle region of Lrp8. Peptide sequence AGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Lrp8 and was validated on Western blot.
Theoretical MW
110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Apolipoprotein E R2/ApoE R2 Antibody

  • ApoER2
  • APOER2HSZ75190
  • Apolipoprotein E R2
  • Apolipoprotein E receptor 2
  • low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
  • low-density lipoprotein receptor-related protein 8
  • Lr8b
  • LRP8
  • LRP-8
  • MCI1


Lrp8 is the cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Lrp8 binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Lrp8 is highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. Lrp8 may also function as an endocytic receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB

Publications for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114) (0)

There are no publications for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114) (0)

There are no reviews for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Apolipoprotein E R2/ApoE R2 Products

Bioinformatics Tool for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114)

Discover related pathways, diseases and genes to Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114)

Discover more about diseases related to Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114).

Pathways for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114)

View related products by pathway.

PTMs for Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114)

Learn more about PTMs related to Apolipoprotein E R2/ApoE R2 Antibody (NBP1-69114).

Blogs on Apolipoprotein E R2/ApoE R2

There are no specific blogs for Apolipoprotein E R2/ApoE R2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Apolipoprotein E R2/ApoE R2 Antibody and receive a gift card or discount.


Gene Symbol LRP8