Apolipoprotein E R2/ApoE R2 Antibody (3H2)

Images

 
Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (3H2) [H00007804-M01] - WB on recombinant immunizing protein.
ELISA: Apolipoprotein E R2/ApoE R2 Antibody (3H2) [H00007804-M01] - Detection limit for recombinant GST tagged LRP8 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein E R2/ApoE R2 Antibody (3H2) Summary

Immunogen
LRP8 (NP_004622 83 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Specificity
LRP8 - low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LRP8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007804-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein E R2/ApoE R2 Antibody (3H2)

  • ApoER2
  • APOER2HSZ75190
  • Apolipoprotein E R2
  • Apolipoprotein E receptor 2
  • low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
  • low-density lipoprotein receptor-related protein 8
  • Lr8b
  • LRP8
  • LRP-8
  • MCI1

Background

This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16095
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00007804-M01
Species: Hu
Applications: WB, ELISA

Publications for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)(1)

Reviews for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01) (0)

There are no reviews for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein E R2/ApoE R2 Products

Bioinformatics Tool for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)

Discover related pathways, diseases and genes to Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)

Discover more about diseases related to Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01).
 

Pathways for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)

View related products by pathway.

PTMs for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)

Learn more about PTMs related to Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01).
 

Research Areas for Apolipoprotein E R2/ApoE R2 Antibody (H00007804-M01)

Find related products by research area.

Blogs on Apolipoprotein E R2/ApoE R2

There are no specific blogs for Apolipoprotein E R2/ApoE R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein E R2/ApoE R2 Antibody (3H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP8
Entrez
OMIM
Uniprot