Apolipoprotein B/ApoB Antibody


Western Blot: apolipoprotein B Antibody [NBP1-69659] - This Anti-APOB antibody was used in Western Blot of Fetal Stomach tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related Apolipoprotein B/ApoB Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Apolipoprotein B/ApoB Antibody Summary

Synthetic peptides corresponding to APOB(apolipoprotein B (including Ag(x) antigen)) The peptide sequence was selected from the middle region of APOB. Peptide sequence SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against APOB and was validated on Western blot.
Theoretical MW
241 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Apolipoprotein B/ApoB Antibody

  • Apo B-100
  • APOB
  • apoB-100
  • apoB-48
  • apolipoprotein B (including Ag(x) antigen)
  • Apolipoprotein B
  • apolipoprotein B-100
  • apolipoprotein B48
  • FLDB
  • LDLCQ4
  • mutant Apo B 100


This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Bv, Rb
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for Apolipoprotein B/ApoB Antibody (NBP1-69659) (0)

There are no publications for Apolipoprotein B/ApoB Antibody (NBP1-69659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein B/ApoB Antibody (NBP1-69659) (0)

There are no reviews for Apolipoprotein B/ApoB Antibody (NBP1-69659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein B/ApoB Antibody (NBP1-69659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Apolipoprotein B/ApoB Antibody (NBP1-69659)

Discover related pathways, diseases and genes to Apolipoprotein B/ApoB Antibody (NBP1-69659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein B/ApoB Antibody (NBP1-69659)

Discover more about diseases related to Apolipoprotein B/ApoB Antibody (NBP1-69659).

Pathways for Apolipoprotein B/ApoB Antibody (NBP1-69659)

View related products by pathway.

PTMs for Apolipoprotein B/ApoB Antibody (NBP1-69659)

Learn more about PTMs related to Apolipoprotein B/ApoB Antibody (NBP1-69659).

Research Areas for Apolipoprotein B/ApoB Antibody (NBP1-69659)

Find related products by research area.

Blogs on Apolipoprotein B/ApoB

There are no specific blogs for Apolipoprotein B/ApoB, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Apolipoprotein B/ApoB Antibody and receive a gift card or discount.


Gene Symbol APOB