Recombinant Human Apolipoprotein A-I/ApoA1 Protein

Images

 
SDS-Page: Recombinant Human Apolipoprotein A-I/ApoA1 Protein [H00000335-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Apolipoprotein A-I/ApoA1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-267 of Human APOA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Protein/Peptide Type
Recombinant Protein
Gene
APOA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein A-I/ApoA1 Protein

  • Alp-1
  • APOA1
  • Apo-AI
  • apoA-I
  • Apolipoprotein A1
  • Apolipoprotein AI
  • Apolipoprotein A-I
  • Brp-14
  • Ltw-1
  • Lvtw-1
  • MGC117399
  • Sep-1
  • Sep-2

Background

APOA1( AAH05380, 1 a.a. - 268 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57716
Species: Hu
Applications: WB
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB200-527
Species: Hu, Mu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC

Publications for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01) (0)

There are no publications for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01) (0)

There are no reviews for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein A-I/ApoA1 Products

Bioinformatics Tool for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01)

Discover related pathways, diseases and genes to Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01)

Discover more about diseases related to Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01).
 

Pathways for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01)

View related products by pathway.

PTMs for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01)

Learn more about PTMs related to Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01).
 

Research Areas for Apolipoprotein A-I/ApoA1 Recombinant Protein (H00000335-P01)

Find related products by research area.

Blogs on Apolipoprotein A-I/ApoA1

There are no specific blogs for Apolipoprotein A-I/ApoA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein A-I/ApoA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA1
Entrez