Apolipoprotein A-I/ApoA1 Antibody

Images

 
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [H00000335-D01P] - Analysis of APOA1 expression in mouse brain.
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [H00000335-D01P] - Analysis of APOA1 expression in HeLa.
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [H00000335-D01P] - Analysis of APOA1 expression in human kidney.
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [H00000335-D01P] - Analysis of APOA1 expression in transfected 293T cell line by APOA1 polyclonal antibody.Lane 1: APOA1 transfected lysate(30.80 KDa).Lane 2: ...read more
Proximity Ligation Assay: Apolipoprotein A-I/ApoA1 Antibody [H00000335-D01P] - Analysis of protein-protein interactions between APOA1 and FGA. HeLa cells were stained with anti-APOA1 rabbit purified polyclonal 1:1200 ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apolipoprotein A-I/ApoA1 Antibody Summary

Immunogen
APOA1 (NP_000030.1, 1 a.a. - 267 a.a.) full-length human protein. MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Specificity
APOA1 - apolipoprotein A-I,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein A-I/ApoA1 Antibody

  • Alp-1
  • APOA1
  • Apo-AI
  • apoA-I
  • Apolipoprotein A1
  • Apolipoprotein AI
  • Apolipoprotein A-I
  • Brp-14
  • Ltw-1
  • Lvtw-1
  • MGC117399
  • Sep-1
  • Sep-2

Background

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57716
Species: Hu
Applications: WB
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB200-527
Species: Hu, Mu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC

Publications for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P) (0)

There are no publications for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P) (0)

There are no reviews for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein A-I/ApoA1 Products

Bioinformatics Tool for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P)

Discover related pathways, diseases and genes to Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P)

Discover more about diseases related to Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P).
 

Pathways for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P)

View related products by pathway.

PTMs for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P)

Learn more about PTMs related to Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P).
 

Research Areas for Apolipoprotein A-I/ApoA1 Antibody (H00000335-D01P)

Find related products by research area.

Blogs on Apolipoprotein A-I/ApoA1

There are no specific blogs for Apolipoprotein A-I/ApoA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein A-I/ApoA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA1
Entrez
Uniprot