API5 Antibody (1C2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related API5 Primary Antibodies

Order Details


    • Catalog Number
      H00008539-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

API5 Antibody (1C2) [DyLight 488] Summary

Immunogen
API5 (AAH17709, 400 a.a. - 504 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
Specificity
API5 (1C2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
API5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for API5 Antibody (1C2) [DyLight 488]

  • AAC-11API5L1
  • AAC11fibroblast growth factor 2-interacting factor 2
  • Antiapoptosis clone 11 protein
  • API-5
  • apoptosis inhibitor 5
  • Cell migration-inducing gene 8 protein
  • Fibroblast growth factor 2-interacting factor
  • FIF
  • migration-inducing protein MIG8
  • Protein XAGL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1704
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008539-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for API5 Antibody (H00008539-M01G) (0)

There are no publications for API5 Antibody (H00008539-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for API5 Antibody (H00008539-M01G) (0)

There are no reviews for API5 Antibody (H00008539-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for API5 Antibody (H00008539-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional API5 Products

Bioinformatics Tool for API5 Antibody (H00008539-M01G)

Discover related pathways, diseases and genes to API5 Antibody (H00008539-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for API5 Antibody (H00008539-M01G)

Discover more about diseases related to API5 Antibody (H00008539-M01G).
 

Pathways for API5 Antibody (H00008539-M01G)

View related products by pathway.

PTMs for API5 Antibody (H00008539-M01G)

Learn more about PTMs related to API5 Antibody (H00008539-M01G).
 

Research Areas for API5 Antibody (H00008539-M01G)

Find related products by research area.

Blogs on API5

There are no specific blogs for API5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our API5 Antibody (1C2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol API5