Recombinant Human APE Protein

Product Discontinued

Recombinant Human APE Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-318 of Human APEX1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

• Protein/Peptide Type: Recombinant Protein
• Gene: APEX1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Functional
  • Immunoaffinity Purification
  • In vitro assay
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. Use in Functional in reported in scientific literature (PMID:17272283). Use in In Vitro Assay reported in scientific literature (PMID: 17272283). This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APE Protein

• AP endonuclease 1
• APE
• APE1
• APE-1
• APEAPEX nuclease (multifunctional DNA repair enzyme)
• APENAP endonuclease class I
• APEX deoxyribonuclease (apurinic or apyrimidinic)
• APEX nuclease (multifunctional DNA repair enzyme) 1
• APEX nuclease
• APEX1
• Apurinic-apyrimidinic endonuclease 1
• APXAP lyase
• DNA-(apurinic or apyrimidinic site) lyase
• EC 3.1
• EC 4.2.99.18
• HAP1apurinic/apyrimidinic (abasic) endonuclease
• multifunctional DNA repair enzyme
• protein REF-1
• redox factor 1
• Redox factor-1
• REF1 apurinic/apyrimidinic exonuclease
• REF-1

Background

APEX1( AAH02338, 1 a.a. - 319 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for APE Recombinant Protein (H00000328-P01)(3)

Publications using H00000328-P01

• Vogel KS, Perez M, MomJR et al. Age-related instability in spermatogenic cell nuclear and mitochondrial DNA obtained from Apex1 heterozygous mice. Molecular Reproduction and Development. 2011-08-05 [PMID: 21919107]
• Zhao J, Gao F, Zhang Y et al. Bcl2 inhibits abasic site repair by down-regulating APE1 endonuclease activity. J Biol Chem 2008-04-11 [PMID: 18263880]
• Yang B, Chen K, Zhang C et al. Virion-associated uracil DNA glycosylase-2 and apurinic/apyrimidinic endonuclease are involved in the degradation of APOBEC3G-edited nascent HIV-1 DNA. J Biol Chem 2007-04-20 [PMID: 17272283] (Func)

Bioinformatics

• Gene Symbol: APEX1