AP2 alpha Antibody (3E6.)

Images

 
Immunocytochemistry/ Immunofluorescence: AP2 alpha Antibody (3E6) [H00007020-M03] - Analysis of monoclonal antibody to TFAP2A on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AP2 alpha Antibody (3E6.) Summary

Immunogen
TFAP2A (AAH17754, 99 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Specificity
TFAP2A - transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (3E6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TFAP2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP2 alpha Antibody (3E6.)

  • Activating enhancer-binding protein 2-alpha
  • Activator protein 2
  • AP-2 transcription factor
  • AP2-alpha
  • AP2TFAP-2alpha
  • AP-2transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
  • BOFS
  • FLJ51761
  • TFAP2
  • transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
  • transcription factor AP-2-alpha

Background

AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5634
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00007020-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for AP2 alpha Antibody (H00007020-M03) (0)

There are no publications for AP2 alpha Antibody (H00007020-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2 alpha Antibody (H00007020-M03) (0)

There are no reviews for AP2 alpha Antibody (H00007020-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AP2 alpha Antibody (H00007020-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP2 alpha Products

Bioinformatics Tool for AP2 alpha Antibody (H00007020-M03)

Discover related pathways, diseases and genes to AP2 alpha Antibody (H00007020-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2 alpha Antibody (H00007020-M03)

Discover more about diseases related to AP2 alpha Antibody (H00007020-M03).
 

Pathways for AP2 alpha Antibody (H00007020-M03)

View related products by pathway.

PTMs for AP2 alpha Antibody (H00007020-M03)

Learn more about PTMs related to AP2 alpha Antibody (H00007020-M03).
 

Research Areas for AP2 alpha Antibody (H00007020-M03)

Find related products by research area.

Blogs on AP2 alpha

There are no specific blogs for AP2 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP2 alpha Antibody (3E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP2A
Entrez
Uniprot