Recombinant Human AP1GBP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AP1GBP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 456-555 of Human AP1GBP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DDFQDFQDASKSGSLDDSFSDFQELPASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYSAFRELEQTAENKPLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SYNRG
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP1GBP1 Protein

  • AP1 gamma subunit binding protein 1
  • AP1 subunit gamma-binding protein 1
  • FLJ34482
  • gamma-synergin
  • MGC104959
  • synergin gamma
  • synergin, gamma
  • SYNGAP1GBP1adaptor-related protein complex 1 gamma subunit-binding protein 1

Background

This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38227
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43567
Species: Hu, Mu
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF1029
Species: Mu
Applications: WB, IHC, IP
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58645
Species: Hu
Applications: WB, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011276-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for AP1GBP1 Partial Recombinant Protein (H00011276-Q01) (0)

There are no publications for AP1GBP1 Partial Recombinant Protein (H00011276-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP1GBP1 Partial Recombinant Protein (H00011276-Q01) (0)

There are no reviews for AP1GBP1 Partial Recombinant Protein (H00011276-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP1GBP1 Partial Recombinant Protein (H00011276-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP1GBP1 Products

Bioinformatics Tool for AP1GBP1 Partial Recombinant Protein (H00011276-Q01)

Discover related pathways, diseases and genes to AP1GBP1 Partial Recombinant Protein (H00011276-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP1GBP1 Partial Recombinant Protein (H00011276-Q01)

Discover more about diseases related to AP1GBP1 Partial Recombinant Protein (H00011276-Q01).
 

Pathways for AP1GBP1 Partial Recombinant Protein (H00011276-Q01)

View related products by pathway.

Blogs on AP1GBP1

There are no specific blogs for AP1GBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AP1GBP1 Antibody
NBP1-90145

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP1GBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNRG