Recombinant Human AP-2 gamma Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AP-2 gamma Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 341-450 of Human AP-2 gamma

Source: Wheat Germ

Amino Acid Sequence: GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TFAP2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP-2 gamma Protein

  • Activating enhancer-binding protein 2 gamma
  • AP2 gamma
  • AP-2 gamma
  • AP2-GAMMA
  • ERF1
  • estrogen receptor factor 1
  • hAP-2g
  • TFAP2C
  • TFAP2G
  • transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
  • transcription factor AP-2 gamma (activating enhancer-binding protein 2 gamma)
  • transcription factor AP-2 gamma
  • Transcription factor ERF-1

Background

TFAP2C - transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-61418
Species: Hu
Applications: WB
H00009617-B01P
Species: Hu
Applications: WB, ELISA
NBP1-85123
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5634
Species: Hu
Applications: WB
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF6386
Species: Hu
Applications: WB, IP
NBP2-16366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-368
Species: Hu
Applications: WB
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-91971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
H00007022-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for AP-2 gamma Partial Recombinant Protein (H00007022-Q01) (0)

There are no publications for AP-2 gamma Partial Recombinant Protein (H00007022-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP-2 gamma Partial Recombinant Protein (H00007022-Q01) (0)

There are no reviews for AP-2 gamma Partial Recombinant Protein (H00007022-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP-2 gamma Partial Recombinant Protein (H00007022-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for AP-2 gamma Partial Recombinant Protein (H00007022-Q01)

Discover related pathways, diseases and genes to AP-2 gamma Partial Recombinant Protein (H00007022-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP-2 gamma Partial Recombinant Protein (H00007022-Q01)

Discover more about diseases related to AP-2 gamma Partial Recombinant Protein (H00007022-Q01).
 

Pathways for AP-2 gamma Partial Recombinant Protein (H00007022-Q01)

View related products by pathway.

PTMs for AP-2 gamma Partial Recombinant Protein (H00007022-Q01)

Learn more about PTMs related to AP-2 gamma Partial Recombinant Protein (H00007022-Q01).

Blogs on AP-2 gamma

There are no specific blogs for AP-2 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP-2 gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP2C
Entrez