Annexin A6 Recombinant Protein Antigen

Images

 
There are currently no images for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Annexin A6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Annexin A6

Source: E.coli

Amino Acid Sequence: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANXA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21228. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Annexin A6 Recombinant Protein Antigen

  • 67 kDa calelectrin
  • Annexin A6
  • annexin VI (p68)
  • Annexin VI
  • Annexin-6
  • ANX6
  • ANXA6
  • calcium-binding protein p68
  • Calelectrin
  • calphobindin II
  • calphobindin-II
  • CBP68
  • chromobindin-20
  • CPB-II
  • CPB-II
  • Lipocortin VI
  • p68
  • p70
  • Protein III

Background

The Annexins constitute a family of structurally-related, relatively abundant proteins that exhibit Ca2+-dependent binding to phospholipids. Annexins function in multiple aspects of cell biology including regulation of membrane trafficking, transmembrane channel activity, inhibition of phospholipase A2, inhibition of coagulation and mediation of cell-matrix interactions. Annexin A13 is considered the original progenitor of the 12 members of vertebrate Annexins. The expression of Annexin A13 is highly tissue-specific, being expressed only in intestinal and kidney epithelial cells. This expression is associated with a highly differentiated intracellular transport function. Two alternative splicing isoforms of Annexin A13 exist, both of which bind to rafts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
485-MI
Species: Mu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
AF1916
Species: Hu
Applications: ICC, IHC, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
409-ML
Species: Mu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
AF4589
Species: Hu
Applications: IHC, WB
NBP3-21228PEP
Species: Hu
Applications: AC

Publications for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP) (0)

There are no publications for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP) (0)

There are no reviews for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Annexin A6 Products

Research Areas for Annexin A6 Recombinant Protein Antigen (NBP3-21228PEP)

Find related products by research area.

Blogs on Annexin A6

There are no specific blogs for Annexin A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Annexin A6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA6