Annexin A6 Antibody


Western Blot: Annexin A6 Antibody [NBP1-59116] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Product Discontinued
View other related Annexin A6 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Annexin A6 Antibody Summary

Synthetic peptides corresponding to ANXA6(annexin A6) The peptide sequence was selected from the C terminal of ANXA6. Peptide sequence SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ANXA6 and was validated on Western blot.
Positive Control
Annexin A6 Lysate (NBP2-65285)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Annexin A6 Antibody

  • 67 kDa calelectrin
  • Annexin A6
  • annexin VI (p68)
  • Annexin VI
  • Annexin-6
  • ANX6
  • ANXA6
  • calcium-binding protein p68
  • Calelectrin
  • calphobindin II
  • calphobindin-II
  • CBP68
  • chromobindin-20
  • CPB-II
  • CPB-II
  • Lipocortin VI
  • p68
  • p70
  • Protein III


Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Annexin A6 Antibody (NBP1-59116) (0)

There are no publications for Annexin A6 Antibody (NBP1-59116).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A6 Antibody (NBP1-59116) (0)

There are no reviews for Annexin A6 Antibody (NBP1-59116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A6 Antibody (NBP1-59116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Annexin A6 Products

Bioinformatics Tool for Annexin A6 Antibody (NBP1-59116)

Discover related pathways, diseases and genes to Annexin A6 Antibody (NBP1-59116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A6 Antibody (NBP1-59116)

Discover more about diseases related to Annexin A6 Antibody (NBP1-59116).

Pathways for Annexin A6 Antibody (NBP1-59116)

View related products by pathway.

PTMs for Annexin A6 Antibody (NBP1-59116)

Learn more about PTMs related to Annexin A6 Antibody (NBP1-59116).

Research Areas for Annexin A6 Antibody (NBP1-59116)

Find related products by research area.

Blogs on Annexin A6

There are no specific blogs for Annexin A6, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Annexin A6 Antibody and receive a gift card or discount.


Gene Symbol ANXA6