Annexin A3 Antibody

Images

 
Western Blot: Annexin A3 Antibody [NBP1-59122] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Annexin A3 Antibody [NBP1-59122] - Human Spleen
Western Blot: Annexin A3 Antibody [NBP1-59122] - Titration: 1.25ug/ml, Positive Control: Human Placenta.

Product Details

Summary
Product Discontinued
View other related Annexin A3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59122
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Annexin A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ANXA3 (annexin A3) The peptide sequence was selected from the N terminal of ANXA3. Peptide sequence MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ANXA3 and was validated on Western Blot and immunohistochemistry-paraffin
Control
Annexin A3 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Annexin A3 Antibody

  • 35-alpha calcimedin
  • Annexin A3
  • annexin A3,1,2-cyclic-inositol-phosphate phosphodiesterase
  • Annexin III
  • annexin-3
  • ANXA3
  • Calcimedin 35-alpha
  • calcimedin 35-alpha
  • Lipocortin III
  • PAP-III
  • Placental anticoagulant protein III
  • placental anticoagulant protein III, calcimedin 35-alpha

Background

The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP1-90162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-76976
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, ICC, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59122
Species: Hu, Eq, Rb
Applications: WB, IHC, IHC-P

Publications for Annexin A3 Antibody (NBP1-59122) (0)

There are no publications for Annexin A3 Antibody (NBP1-59122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A3 Antibody (NBP1-59122) (0)

There are no reviews for Annexin A3 Antibody (NBP1-59122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A3 Antibody (NBP1-59122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Annexin A3 Products

Bioinformatics Tool for Annexin A3 Antibody (NBP1-59122)

Discover related pathways, diseases and genes to Annexin A3 Antibody (NBP1-59122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A3 Antibody (NBP1-59122)

Discover more about diseases related to Annexin A3 Antibody (NBP1-59122).
 

Pathways for Annexin A3 Antibody (NBP1-59122)

View related products by pathway.

PTMs for Annexin A3 Antibody (NBP1-59122)

Learn more about PTMs related to Annexin A3 Antibody (NBP1-59122).

Blogs on Annexin A3

There are no specific blogs for Annexin A3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA3