Recombinant Human ANKRD17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ANKRD17 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2501-2603 of Human ANKRD17 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG

Protein/Peptide Type
Partial Recombinant Protein
Gene
ANKRD17

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ANKRD17 Protein

  • ankyrin repeat domain 17
  • ankyrin repeat domain-containing protein 17
  • Gene trap ankyrin repeat protein
  • GTARSerologically defined breast cancer antigen NY-BR-16
  • KIAA0697FLJ22206
  • NY-BR-16

Background

ANKRD17 - ankyrin repeat domain 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91867
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00404734-R01
Species: Hu

Publications for ANKRD17 Partial Recombinant Protein (H00026057-Q01) (0)

There are no publications for ANKRD17 Partial Recombinant Protein (H00026057-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD17 Partial Recombinant Protein (H00026057-Q01) (0)

There are no reviews for ANKRD17 Partial Recombinant Protein (H00026057-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD17 Partial Recombinant Protein (H00026057-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ANKRD17 Products

Bioinformatics Tool for ANKRD17 Partial Recombinant Protein (H00026057-Q01)

Discover related pathways, diseases and genes to ANKRD17 Partial Recombinant Protein (H00026057-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD17 Partial Recombinant Protein (H00026057-Q01)

Discover more about diseases related to ANKRD17 Partial Recombinant Protein (H00026057-Q01).
 

Pathways for ANKRD17 Partial Recombinant Protein (H00026057-Q01)

View related products by pathway.

PTMs for ANKRD17 Partial Recombinant Protein (H00026057-Q01)

Learn more about PTMs related to ANKRD17 Partial Recombinant Protein (H00026057-Q01).

Blogs on ANKRD17

There are no specific blogs for ANKRD17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ANKRD17 Antibody
NB100-86996

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ANKRD17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD17