Recombinant Human ANKRD15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ANKRD15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 701-800 of Human ANKRD15 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD

Protein/Peptide Type
Partial Recombinant Protein
Gene
KANK1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ANKRD15 Protein

  • ANKRD15ankyrin repeat domain 15
  • Ankyrin repeat domain-containing protein 15
  • KANKDKFZp451G231
  • KIAA0172MGC43128
  • Kidney ankyrin repeat-containing protein
  • KN motif and ankyrin repeat domain-containing protein 1
  • KN motif and ankyrin repeat domains 1

Background

ANKRD15 - ankyrin repeat domain 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-90452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00027130-P02
Species: Hu
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
H00058524-R01
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-04508
Species: Hu
AF3505
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00023189-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ANKRD15 Partial Recombinant Protein (H00023189-Q01) (0)

There are no publications for ANKRD15 Partial Recombinant Protein (H00023189-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD15 Partial Recombinant Protein (H00023189-Q01) (0)

There are no reviews for ANKRD15 Partial Recombinant Protein (H00023189-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD15 Partial Recombinant Protein (H00023189-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ANKRD15 Products

Bioinformatics Tool for ANKRD15 Partial Recombinant Protein (H00023189-Q01)

Discover related pathways, diseases and genes to ANKRD15 Partial Recombinant Protein (H00023189-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD15 Partial Recombinant Protein (H00023189-Q01)

Discover more about diseases related to ANKRD15 Partial Recombinant Protein (H00023189-Q01).
 

Pathways for ANKRD15 Partial Recombinant Protein (H00023189-Q01)

View related products by pathway.

PTMs for ANKRD15 Partial Recombinant Protein (H00023189-Q01)

Learn more about PTMs related to ANKRD15 Partial Recombinant Protein (H00023189-Q01).
 

Research Areas for ANKRD15 Partial Recombinant Protein (H00023189-Q01)

Find related products by research area.

Blogs on ANKRD15

There are no specific blogs for ANKRD15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ANKRD15 Antibody
NBP1-90167

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ANKRD15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KANK1