ANKRD13C Antibody

Images

 
Immunohistochemistry: ANKRD13C Antibody [NBP1-90568] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD13C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD13C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD13C Protein (NBP1-90568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD13C Antibody

  • ankyrin repeat domain 13C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ANKRD13C Antibody (NBP1-90568) (0)

There are no publications for ANKRD13C Antibody (NBP1-90568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD13C Antibody (NBP1-90568) (0)

There are no reviews for ANKRD13C Antibody (NBP1-90568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKRD13C Antibody (NBP1-90568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD13C Products

Bioinformatics Tool for ANKRD13C Antibody (NBP1-90568)

Discover related pathways, diseases and genes to ANKRD13C Antibody (NBP1-90568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD13C Antibody (NBP1-90568)

Discover more about diseases related to ANKRD13C Antibody (NBP1-90568).
 

Pathways for ANKRD13C Antibody (NBP1-90568)

View related products by pathway.

PTMs for ANKRD13C Antibody (NBP1-90568)

Learn more about PTMs related to ANKRD13C Antibody (NBP1-90568).

Blogs on ANKRD13C

There are no specific blogs for ANKRD13C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD13C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD13C