ANKMY2 Antibody

Images

 
Immunohistochemistry: ANKMY2 Antibody [NBP2-32032] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: ANKMY2 Antibody [NBP2-32032] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related ANKMY2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32032
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ANKMY2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKMY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKMY2 Antibody

  • ankyrin repeat and MYND domain containing 2
  • ankyrin repeat and MYND domain-containing protein 2
  • DKFZP564O043
  • ZMYND20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-16927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-38008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14116
Species: Hu
Applications: IHC, IHC-P

Publications for ANKMY2 Antibody (NBP2-32032) (0)

There are no publications for ANKMY2 Antibody (NBP2-32032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKMY2 Antibody (NBP2-32032) (0)

There are no reviews for ANKMY2 Antibody (NBP2-32032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKMY2 Antibody (NBP2-32032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKMY2 Products

Bioinformatics Tool for ANKMY2 Antibody (NBP2-32032)

Discover related pathways, diseases and genes to ANKMY2 Antibody (NBP2-32032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ANKMY2 Antibody (NBP2-32032)

View related products by pathway.

Blogs on ANKMY2

There are no specific blogs for ANKMY2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKMY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKMY2
Uniprot