ANKLE2 Antibody


Western Blot: ANKLE2 Antibody [NBP1-70407] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ANKLE2 Antibody Summary

Synthetic peptides corresponding to KIAA0692 The peptide sequence was selected from the middle region of KIAA0692. Peptide sequence CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIAA0692 and was validated on Western blot.
Theoretical MW
104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKLE2 Antibody

  • ankyrin repeat and LEM domain containing 2
  • ankyrin repeat and LEM domain-containing protein 2
  • FLJ22280
  • FLJ36132
  • KIAA0692
  • LEM domain containing 7
  • LEMD7


KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB

Publications for ANKLE2 Antibody (NBP1-70407) (0)

There are no publications for ANKLE2 Antibody (NBP1-70407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKLE2 Antibody (NBP1-70407) (0)

There are no reviews for ANKLE2 Antibody (NBP1-70407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKLE2 Antibody (NBP1-70407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ANKLE2 Products

ANKLE2 NBP1-70407

Bioinformatics Tool for ANKLE2 Antibody (NBP1-70407)

Discover related pathways, diseases and genes to ANKLE2 Antibody (NBP1-70407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKLE2 Antibody (NBP1-70407)

Discover more about diseases related to ANKLE2 Antibody (NBP1-70407).

Pathways for ANKLE2 Antibody (NBP1-70407)

View related products by pathway.

PTMs for ANKLE2 Antibody (NBP1-70407)

Learn more about PTMs related to ANKLE2 Antibody (NBP1-70407).

Blogs on ANKLE2

There are no specific blogs for ANKLE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKLE2 Antibody and receive a gift card or discount.


Gene Symbol ANKLE2