Recombinant Human Anillin Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Anillin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-405 of Human ANLN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKRTLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFRARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ANLN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
70.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Anillin Protein

  • actin-binding protein anillin
  • anillin (Drosophila Scraps homolog), actin binding protein
  • ANILLIN
  • anillin, actin binding protein (scraps homolog, Drosophila)
  • anillin, actin binding protein
  • DKFZp779A055
  • Drosophila Scraps homolog
  • scra
  • Scraps

Background

ANLN( AAH34692, 1 a.a. - 406 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-P01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00347527-P01
Species: Hu
MAB38461
Species: Hu
Applications: WB, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-89158
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00054443-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Anillin Recombinant Protein (H00054443-P01) (0)

There are no publications for Anillin Recombinant Protein (H00054443-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Anillin Recombinant Protein (H00054443-P01) (0)

There are no reviews for Anillin Recombinant Protein (H00054443-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Anillin Recombinant Protein (H00054443-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Anillin Products

Bioinformatics Tool for Anillin Recombinant Protein (H00054443-P01)

Discover related pathways, diseases and genes to Anillin Recombinant Protein (H00054443-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Anillin Recombinant Protein (H00054443-P01)

Discover more about diseases related to Anillin Recombinant Protein (H00054443-P01).
 

Pathways for Anillin Recombinant Protein (H00054443-P01)

View related products by pathway.

PTMs for Anillin Recombinant Protein (H00054443-P01)

Learn more about PTMs related to Anillin Recombinant Protein (H00054443-P01).

Blogs on Anillin

There are no specific blogs for Anillin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Anillin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANLN