Angiopoietin-like Protein 3/ANGPTL3 Antibody

Images

 
Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-57100] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Angiopoietin-like Protein 3/ANGPTL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ANGPTL3(angiopoietin-like 3) The peptide sequence was selected from the N terminal of ANGPTL3. Peptide sequence IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANGPTL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ANGPTL3 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Angiopoietin-like Protein 3/ANGPTL3 Antibody

  • AGNPT5
  • Ang-5
  • angiopoietin 5
  • Angiopoietin-5
  • angiopoietin-like 3
  • Angiopoietin-like Protein 3
  • angiopoietin-related protein 3
  • ANGPT5angiopoietin-5
  • ANGPTL3
  • FHBL2

Background

The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil dom

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBP2-15394
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-527
Species: Hu, Mu
Applications: WB
NBP2-46205
Species: Hu
Applications: WB, IHC
AF1444
Species: Mu
Applications: WB, IHC
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP1-85870
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-57100
Species: Hu
Applications: WB

Publications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100) (0)

There are no publications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100) (0)

There are no reviews for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Angiopoietin-like Protein 3/ANGPTL3 Products

Bioinformatics Tool for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100)

Discover related pathways, diseases and genes to Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100)

Discover more about diseases related to Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100).
 

Pathways for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100)

View related products by pathway.

PTMs for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100)

Learn more about PTMs related to Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100).
 

Research Areas for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-57100)

Find related products by research area.

Blogs on Angiopoietin-like Protein 3/ANGPTL3

There are no specific blogs for Angiopoietin-like Protein 3/ANGPTL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Angiopoietin-like Protein 3/ANGPTL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANGPTL3
Entrez
Uniprot